Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Rabbit polyclonal anti-PROKR2 antibody, 25 uL, Cat# B0220109

Images
 
Save 3%
Product Details
Summary
List price: $180.00
$175.00
You save: $5.00 (3%)
B0220109
In stock
+

Minimum quantity for "Rabbit polyclonal anti-PROKR2 antibody, 25 uL, Cat# B0220109" is 1.

Note
 

Rabbit polyclonal anti-PROKR2 antibody, 25 uL, Cat# B0220109

Product Description
 

Rabbit polyclonal anti-PROKR2 antibody, 25 uL, Cat# B0220109

Rabbit polyclonal antibody recognizing human PROKR2 (prokineticin receptor 2) protein.

Source: Rabbit

Immunogen: AAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTF

Purity: >95% by SDS-PAGE

Application: For EIA and Western blot

Storage buffer: 0.015 M potassium phosphate buffer, 0.85% NaCl, 0.05% NaN3 pH7.2

Storage condition: 2-8oC for 1 year. Long-term store at -20oC.

Product Documents: Please login to view the documents in the attachments tab.

Product PDFs
 
 

COA (B21231281_5-FAM-mAb_APX1101211-COA.pdf, 55 Kb) []