AmeriDx® Recombinant Human Anti-Muellerian Hormone (AMH/MIS) Protein (Item No 21231235 ), 100 ug

 AmeriDx® Recombinant Human Anti-Muellerian Hormone (AMH) Protein (Item No 21231235 )


$155.60
21231235
In stock

Minimum quantity for "AmeriDx® Recombinant Human Anti-Muellerian Hormone (AMH/MIS) Protein (Item No 21231235 ), 100 ug" is 1.

AmeriDx® Recombinant Human Anti-Muellerian Hormone (AMH/MIS) Protein (Item No 21231235 )

CATALOG NUMBER: 21231235

PROTEIN NAME: Anti-Mullerian Hormone (AMH), Mullerian-inhibiting factor (MIF), Mullerian-inhibiting substance (MIS).

DESCRIPTION:

The Human AMH is synthesized by the granulosa cells of the preantral and early developing antral follicles, belongs to the transforming growth factor beta superfamily [1]. AMH is a hormone involving sex organs development in wombs, and a ovary biomarker for reproduction diseases such as polycystic syndrome[2]. it's primary physiological function in the ovary is to prevent primordial follicles recruitment and regulate FSH secretion in the early follicular phase [3].

SIZE: 0.1 mg/ 1 mg/ 5 mg

SOURCE: human AMH gene cloned into Mammalian cell lines

SEQUENCES (P03971 A453-R560)

AGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARGAA
LARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCRLESRGPEQKLISEEDLNSAVDHHHHHH
  

HOST: E coli

MOLECULAR WEIGHT: 14.8 kDa

PURITY: >95% by SDS-PAGE analysis

STORAGE BUFFER: 1x PBS with 0.5% trehalose.

RECONSTITION AND STORAGE: This product is shipped with blue ice, please store at freezer below -20oC. Reconstitute with 1x PBS before use.

APPLICATION NOTES: n/a

REFERENCES

1. Pellatt L, Hanna L, Brincat M, et al. Granulosa cell production of anti-Müllerian hormone is increased in polycystic ovaries. J Clin Endocrinol Metab. 2007; 92(1): 240–245, doi: 10.1210/jc.2006-1582. PMID: 17062765.

2. Ozay AC, Emekcı Ozay O, Gulekli B. Comparison of Anti-müllerian Hormone (AMH) and Hormonal Assays for Phenotypic Classification of Polycystic Ovary Syndrome. Ginekol Pol. 2020;91(11):661-667. doi: 10.5603/GP.a2020.0122. PMID: 33301159.

3. La Marca A, Broekmans FJ, Volpe A, et al. ESHRE Special Interest Group for Reproductive Endocrinology--AMH Round Table. Anti-Mullerian hormone (AMH): what do we still need to know? Hum Reprod. 2009; 24(9): 2264–2275. PMID: 19520713.

 

SDS (AmeriDx_AMH-Antigen_SDS_rev1.2.pdf, 218 Kb) [Download]

Product Insert (Product-information-AMH-C.pdf, 148 Kb) [Download]

C0220114
$99.00

AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU

In stock

Minimum quantity for "AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU" is 1.


21231222
$499.00

Cytotoxin associated gene A (CagA), recombinant CagA protein cagA2d domain

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant CagA Protein, 1 mg" is 1.


21232111
$499.00

Recombinant H. pylori Catalase A (KatA) protein, 59 kDa from E coli strain

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant KatA (Catalase) Protein, 1 mg" is 1.


21231247
$499.00

Helicobacter pylori Urease subunit A (UreA) protein is an important component of the bacterial ecosystem in humans. It is an obligate intracellular protein that binds to class II MHC on gastric epithelial cells.

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant UreA Protein, 1 mg" is 1.


21231248
$499.00

E. coli derived H. pylori Urease subunit B (UreB) protein

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant Urease subunit B (UreB) Protein, 1 mg" is 1.