AmeriDx® H. pylori Antigen - Recombinant KatA (Catalase) Protein, 1 mg

Recombinant H. pylori Catalase A (KatA) protein, 59 kDa from E coli strain

$499.00
21232111
In stock
Our quantity discounts:
Quantity 10+
Price $3,950.00

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant KatA (Catalase) Protein, 1 mg" is 1.

Catalog Number: 21232111

Size: 1 mg / 10 mg

Source: E. coli derived H. pylori KatA (Catalase) Protein

             NCBI ID: WP_000247318

Sequences:

GSNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLE
KLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKI
FSKVGKKTECFFRFSTVAGEKGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNP
DMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHT
FSLINAKGERFWVKFHFETMQGVKHLTNEEAAEVRKYDPD
SNQRDLFDAIAGGDFPKWKMSIQVMPEEDAKKYRFHPFDV
TKIWYLQDYPLMEVGIVELNKNPENYFAEVEQAAFTPANV
VPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNRPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDP
KFNLAHIEKEFEVWNWDYRAEDSDYYTQPGDYYRSLPADE
KERLYDTIGGSLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHAKDMHHMKKKK

Host: E. coli

Format: Dry Powder

Reactivity: Immune assay with AmeriDx® H. pylori antibodies.

QC Testing: Concentration Measurement, SDS-PAGE Analysis.

Formulation and Purity

Recombinant protein was over-expressed in E coli strain BL21, and affinity purified from cell pellet by Ni-NTA resin, and dialysis against 1x PBS. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured by Nanodrop.

Storage Buffer: In PBS before lyophilized

Preparation and Storage

Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.

Description

Serum Catalase (KatA) and AhpC antibodies are associated with GC risk and KatA may serve as a biomarker for GC. KatA/FlaA combined analysis improved screening accuracy[1].

Product Notices

  • Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  • Please refer to www.ameridx.com/ for technical protocols.

References

1.  Zhang B, Li HL, Fan Q, Guo F, Ren XY, Zhou HB, Zhu JW, Zhao YS, Tian WJ. Serum Helicobacter pylori KatA and AhpC antibodies as novel biomarkers for gastric cancer. World J Gastroenterol. 2016 Jun 7;22(21):5060-7. doi: 10.3748/wjg.v22.i21.5060. PMID: 27275098; PMCID: PMC4886381.

 

Product Insert can be after login.

R30142004
$450.00

AmeriDx® Fecal H. pylori Ag Rapid Test Kit is an in vitro qualitative immunochromatographic assay for the rapid detection of Helicobacter pylori (H. pylori) antigens in human stool specimen. The test results are intended to aid in the diagnosis of H. pylori infection, to monitor the effectiveness of therapeutic treatment, and to confirm the eradication of H. pylori in patients with peptic ulcer.

In stock

21231222
$499.00

Cytotoxin associated gene A (CagA), recombinant CagA protein cagA2d domain

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant CagA Protein, 1 mg" is 1.


21232111
$499.00

Recombinant H. pylori Catalase A (KatA) protein, 59 kDa from E coli strain

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant KatA (Catalase) Protein, 1 mg" is 1.


21232112
$499.00

AmeriDx® H. pylori Antigen - Recombinant VacA Protein

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant VacA Protein, 1 mg" is 1.


21231247
$499.00

Helicobacter pylori Urease subunit A (UreA) protein is an important component of the bacterial ecosystem in humans. It is an obligate intracellular protein that binds to class II MHC on gastric epithelial cells.

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant UreA Protein, 1 mg" is 1.


21231248
$499.00

E. coli derived H. pylori Urease subunit B (UreB) protein

In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant Urease subunit B (UreB) Protein, 1 mg" is 1.


B21231168
$230.00 $190.00


Mouse monoclonal Anti-Helicobacter pylori (H. Pylori) antibody, DEAE chromatography purified.

In stock

Minimum quantity for "Anti-Helicobacter pylori (H. Pylori) Mouse Monoclonal Antibody, 1 mg (Cat# B21231168)" is 1.


B21231169
$230.00 $190.00

Mouse monoclonal Anti-Helicobacter pylori (H. Pylori) antibody, DEAE chromatography purified.

In stock

Minimum quantity for "Anti-Helicobacter pylori (H. Pylori) Mouse Monoclonal Antibody, 1 mg (Cat# B21231169)" is 1.