Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

AmeriDx® H. pylori Antigen - Recombinant KatA (Catalase) Protein, 1 mg

Images
 
Product Details
Summary
$299.00
21232111
In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant KatA (Catalase) Protein, 1 mg" is 1.

Note
 

Cytotoxin associated gene A (CagA), recombinant CagA protein, cagA2d domain

Product Description
 

Catalog Number: 21232111

Size: 100 ug

Source: E. coli derived H. pylori KatA (Catalase) Protein

             NCBI ID: WP_000247318

Sequences:

GSNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLE
KLAAFDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKI
FSKVGKKTECFFRFSTVAGEKGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNP
DMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHT
FSLINAKGERFWVKFHFETMQGVKHLTNEEAAEVRKYDPD
SNQRDLFDAIAGGDFPKWKMSIQVMPEEDAKKYRFHPFDV
TKIWYLQDYPLMEVGIVELNKNPENYFAEVEQAAFTPANV
VPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNRPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDP
KFNLAHIEKEFEVWNWDYRAEDSDYYTQPGDYYRSLPADE
KERLYDTIGGSLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHAKDMHHMKKKK

Host: E. coli

Format: Dry Powder

Reactivity: Immune assay with AmeriDx® H. pylori antibodies.

QC Testing: Concentration Measurement, SDS-PAGE Analysis.

Formulation and Purity

Recombinant protein was over-expressed in E coli strain BL21, and affinity purified from cell pellet by Ni-NTA resin, and dialysis against 1x PBS. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured by Nanodrop.

Storage Buffer: In PBS before lyophilized

Preparation and Storage

Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.

Description

Serum Catalase (KatA) and AhpC antibodies are associated with GC risk and KatA may serve as a biomarker for GC. KatA/FlaA combined analysis improved screening accuracy[1].

Product Notices

  • Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  • Please refer to www.ameridx.com/ for technical protocols.

References

1.  Zhang B, Li HL, Fan Q, Guo F, Ren XY, Zhou HB, Zhu JW, Zhao YS, Tian WJ. Serum Helicobacter pylori KatA and AhpC antibodies as novel biomarkers for gastric cancer. World J Gastroenterol. 2016 Jun 7;22(21):5060-7. doi: 10.3748/wjg.v22.i21.5060. PMID: 27275098; PMCID: PMC4886381.

 

Product Insert can be after login.

Product PDFs