Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

AmeriDx® H. pylori Antigen - Recombinant UreB Protein (21231248), 1 mg

Images
 
Product Details
Summary
$299.00
21231248
In stock

Minimum quantity for "AmeriDx® H. pylori Antigen - Recombinant UreB Protein (21231248), 1 mg" is 1.

Note
 

H. pylori Antigen - Recombinant UreB Protein

Product Description
 

Catalog Number: 21231248

Size: 100 ug

Source: E. coli derived H. pylori Urease subunit B (UreB) protein

             NCBI ID: WP_000724277.1

Sequences:

MKKISRKEYASMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELKFGGGKTLREGMSQSNNPSKEELDLII
TNALIVDYTGIYKADIGIKDGKIAGIGKGGNKDMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHFI
SPQQIPTAFASGVTTMIGGGTGPADGTNATTITPGRRNLKFMLRAAEEYSMNFGFLAKGNVSNDASLADQ
IEAGAIGFKIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTFHTEGAGG
GHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQFADSRIRPQTIAAEDTL
HDMGIFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKEEKGDNDNFRIKRYLSKYTINPAIAHGIS
EYVGSVEVGKVADLVLWSPAFFGVKPNMIIKGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDAN
ITFVSQAAYDKGIKEELGLERQVLPVKNCRNITKKDMQFNDTTAHIEVNSETYHVFVDGKEVTSKPANKV
SLAQLFSIF

Host: E. coli

Format: Dry Powder

Reactivity: Immune assay with AmeriDx® H. pylori UreB antibodies.

QC Testing: Concentration Measurement, SDS-PAGE Analysis.

Formulation and Purity

Recombinant protein accession no WP_000724277.1, over-expressed in E coli strain BL21, and affinity purification from cell pellet by Ni-NTA resin, and dialysis against 1x PBS. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured by Nanodrop.

Storage Buffer: In PBS before lyophilized

Preparation and Storage

Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.

Description

This enzyme may allow it to remain active at the cell surface at acidic gastric pH. Within this dodecameric structure the 12 active sites are clustered within the interior of the proteinaceous shell. This may allow a high local concentration of ammonia within the enzyme which may protect the nickel-chelating groups from protonation (https://www.uniprot.org/uniprot/P14916).

Product Notices

  • Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  • Please refer to www.ameridx.com/ for technical protocols.

References

1.  Olivera-Severo, D., et al. (2017). "A New Role for Helicobacter pylori Urease: Contributions to Angiogenesis." Front Microbiol 8(1883).


Product Insert can be after login.

Product PDFs