AmeriDx® Recombinant Poliovirus RdRp Protein (21231287), 1 mg

Catalog Number: 21231287

Size: 1 mg

Source: RdRp (3Dpol) protein from insect sf9 cells.

             NCBI ID: AIS73056/1762E-2188F

Sequences:

GSEGSKEPAVLNPKDPRLKTDFEEAIFSKYTGNKIMLMDEYMEEAVDHYVGCLEPLDISVDPIPLESAMYGMDGLEALDL
TTSAGFPYLLQGKKKRDIFNRHTRDTTEMTKMLEKYGVDLPFVTFVKDELRSREKVEKGKSRLIEASSLNDSVAMRVAFG
NLYATFHSNPGTATGSAVGCDPDIFWSKIPILLDGEIFAFDYTGYDASLSPVWFACLKKVLIKLGYTHQTSFIDYLCHSV
HLYKDRKYIVNGGMPSGSSGTSIFNTMINNIIIRTLLIRVYKGIDLDQFKMIAYGDDVIASYPHKIDPGLLAEAGKHYGL
VMTPADKGTSFVDTNWENVTFLKRYFRADDQYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCYLAWHNGEEAYDEF
CRKIRSVPVGRALTLPAYSSLRRKWLDSFLER

Host: sf9 cells

Format: Dry Powder

Reactivity: Immune assay with RdRp monoclonal antibody.

QC Testing: Concentration Measurement, SDS-PAGE Analysis.

Formulation and Purity

Recombinant protein AIS73056 region 1762E-2188F with 6-Histine tag at C-terminal from insect cells sf9 in 1 x PBS. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured by Nanodrop.

Storage Buffer: In PBS before lyophilized

Preparation and Storage

Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.

Description

Polio virus RdRp protein is key player in virus invading into human cells, and virus RNA replication inside human cells^[1,2,3]. the protein has a right hand palm structure, similar to covid-19 RdRp, zika virus RdRp and dengue virus RdRp proteins^[4,5]. 

The purified protein is part of full length RdRp protein with a c-terminal his tag.

Product Notices

• Since applications vary, each investigator should titrate the reagent to obtain optimal results.
• Please refer to www.ameridx.com/ for technical protocols.

References

1.   Comunale, B. A., et al. (2021). "Poliovirus Vaccination Induces a Humoral Immune Response That Cross Reacts With SARS-CoV-2." Frontiers in Medicine 8(1285).

2. Wolf YI, Kazlauskas D, Iranzo J, Lucía-Sanz A, Kuhn JH, Krupovic M, et al. Origins and evolution of the global RNA virome. MBio. (2018) 9:e02329–18. doi: 10.1128/mBio.02329-18.

3. Arya R, Kumari S, Pandey B, Mistry H, Bihani SC, Das A, Prashar V, Gupta GD, Panicker L, Kumar M. Structural insights into SARS-CoV-2 proteins. J Mol Biol. 2021 Jan 22;433(2):166725. doi: 10.1016/j.jmb.2020.11.024. Epub 2020 Nov 24. PMID: 33245961; PMCID: PMC7685130.

4. Venkataraman S, Prasad BVLS, Selvarajan R. RNA Dependent RNA Polymerases: Insights from Structure, Function and Evolution. Viruses. 2018 Feb 10;10(2):76. doi: 10.3390/v10020076. PMID: 29439438; PMCID: PMC5850383.

5. Lu G, Gong P. A structural view of the RNA-dependent RNA polymerases from the Flavivirus genus. Virus Res. 2017 Apr 15;234:34-43. doi: 10.1016/j.virusres.2017.01.020. Epub 2017 Jan 25. PMID: 28131854.

Product Insert can be after login.