Save 34%

AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU

AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU

List price: $99.00
$65.00
You save: $34.00 (34%)
C0220114
In stock
Our quantity discounts:
Quantity 5+
Price $130.00

Minimum quantity for "AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU" is 1.

CATALOG NUMBER: C0220114

SIZE: 100 IU

PROTEIN INFO: E. coli derived bovine Enterokinase 

             NCBI ID: AAA16035

DESCRIPTION

Enterokinase (EK) is synthesized by duodenum cells involving digestion. It cleaves the N terminal peptide of trypsinogen to produce active form trypsin[1]. The specific cleavage site for EK is four aspartic acids Asp-Asp-Asp-Asp-Lys following by a lysine, not following by proline.

Recombinant Bovine Enterokinase (bEK) as the light chain is a single glycosylated polypeptide chain containing 200 amino acids. A fully biologically active form is prepared by America Diagnostics using its proprietary recombinant protein technology modified from Vozza (1996) protocol[2].

SEQUENCES

GSIVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSP
QIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQG
STADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFG
YQCALPNRPGVYARVPRFTEWIQSFLLEM

HOST: E. coli

FORMAT: Dry Powder

REACTIVITY: Unit Definition: One unit is defined as the amount of enzyme needed to cleave 50 μg of fusion protein in 16 hours to 95% completion at 22°C in a buffer containing 25mM Tris-HCl, pH 8.0.

FORMULATION AND PURITY

Recombinant protein over-expressed in E coli strain BL21, and affinity purification from inclusion body by Ni-NTA resin. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured by Nanodrop.

Fig 1. bEK purified from E coli inclusion body. L, protein ladder. protein amount: 1, 30 ug; 2, 15 ug; 3, 7.5 ug.

STORAGE BUFFER: In PBS before lyophilized

RECONSTITUTION AND STORAGE

Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.

PRODUCT NOTICES

  • Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  • Please refer to www.ameridx.com/ for technical protocols.

REFERENCES

1. I. Yamashina. The action of enterokinase on trypsinogen. Acta Chem. Scand., 10 (1956), pp. 739-743.

2. Vozza, L. A., et al. (1996). "Production of a recombinant bovine enterokinase catalytic subunit in the methylotrophic yeast Pichia pastoris." Biotechnology (N Y) 14(1): 77-81.

Datasheet (Product-information-bEK-v2.pdf, 187 Kb) [Download]

SDS (AmeriDx_bEK-Antigen_SDS_rev1.0.pdf, 218 Kb) [Download]

R30142004
$450.00

AmeriDx® Fecal H. pylori Ag Rapid Test Kit is an in vitro qualitative immunochromatographic assay for the rapid detection of Helicobacter pylori (H. pylori) antigens in human stool specimen. The test results are intended to aid in the diagnosis of H. pylori infection, to monitor the effectiveness of therapeutic treatment, and to confirm the eradication of H. pylori in patients with peptic ulcer.

In stock

B21231168
$230.00 $190.00


Mouse monoclonal Anti-Helicobacter pylori (H. Pylori) antibody, DEAE chromatography purified.

In stock

Minimum quantity for "Anti-Helicobacter pylori (H. Pylori) Mouse Monoclonal Antibody, 1 mg (Cat# B21231168)" is 1.


B21231169
$230.00 $190.00

Mouse monoclonal Anti-Helicobacter pylori (H. Pylori) antibody, DEAE chromatography purified.

In stock

Minimum quantity for "Anti-Helicobacter pylori (H. Pylori) Mouse Monoclonal Antibody, 1 mg (Cat# B21231169)" is 1.