AmeriDx® Neurofilament Light Polypeptide Protein (NF-L), from 0.1 mg, Catalog No 21233337

AmeriDx® Neurofilament Light Polypeptide Protein (NF-L), 0.1 mg

$435.00
21233337
In stock
Our quantity discounts:
Quantity 10+ 20+
Price $2,320.00 $3,570.00

Minimum quantity for "AmeriDx® Neurofilament Light Polypeptide Protein (NF-L), from 0.1 mg, Catalog No 21233337" is 1.

CATALOG NUMBER: 21233337

SIZE: 100 ug/1 mg/2 mg

Synonyms: Neurofilament light polypeptide, 68 kDa neurofilament protein, neurofilament triplet L protein

PROTEIN INFO: Full length NF-L protein purified from insect cells

Accession ID: P07196

DESCRIPTION

Neurofilament consists of three major components: neurofilament light polypeptide (NF-L), mediate polypeptide (NF-M), and heavy polypeptide (NL-H). NF-L has 542 amino acid  including a 91 aa N-terminal head, a 304 aa alpha -helical rod, and a 147 aa C-terminal tail[1]. NF-L is first reported as a 69 kDa protein from by  Hoffman and Lasek in 1975 analyzing the axonal transport paradigm[2], it plays an important role in the maintenance of neuronal caliber and possibly the pathogenesis of motor neuron diseases[3, 4].

SEQUENCES

MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQAQIQY
AQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA
AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRT
TKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFG
RSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSEGEAEEEE
KDKEEAEEEEAAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAK
KKD

FORMAT: Dry Powder

Predicted Molecular Mass: 61 kDa

REACTIVITY: Immune assay with AmeriDx® NF-L antibodies: B0220112, B0220113, B0220114, B0220115, B0220116, B0220117, 0220118.

FORMULATION AND PURITY

Recombinant protein is over-expressed in Drosophila s2 cells, and purified by Ni-NTA resin, and dialysis against 1x PBS. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured at O.D280nm by Nanodrop.

STORAGE BUFFER: In PBS before lyophilized

RECONSTITUTION AND STORAGE

Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.

APPLICATION NOTES

     n/a

Product Notices

  • Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  • Please refer to www.ameridx.com/ for technical protocols.

References

1.     Adebola, A.A., et al., Neurofilament light polypeptide gene N98S mutation in mice leads to neurofilament network abnormalities and a Charcot-Marie-Tooth Type 2E phenotype. Hum Mol Genet, 2015. 24(8): p. 2163-74.

2.     Hoffman, P.N. and R.J. Lasek, The slow component of axonal transport. Identification of major structural polypeptides of the axon and their generality among mammalian neurons. Journal of Cell Biology, 1975. 66(2): p. 351-366.

3.     Xu, Z., et al., Increased expression of neurofilament subunit NF-L produces morphological alterations that resemble the pathology of human motor neuron disease. Cell, 1993. 73(1): p. 23-33.

4.     Monteiro, M.J., et al., Expression of NF-L in both neuronal and nonneuronal cells of transgenic mice: increased neurofilament density in axons without affecting caliber. J Cell Biol, 1990. 111(4): p. 1543-57.


 

Product Insert can be after login.

Product Insert (Product-information-NF-L.pdf, 196 Kb) [Download]

C0220114
$99.00 $65.00

AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU

In stock

Minimum quantity for "AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU" is 1.


21233339
$435.00

AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal Q93-E396 , from 0.1 mg, Catalog No 21233339

In stock

Minimum quantity for "AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal Q93-E396 , from 0.1 mg, Catalog No 21233339" is 1.


21233338
$435.00

AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal S2-D338 , from 0.1 mg, Catalog No 21233338

In stock

Minimum quantity for "AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal S2-D338 , from 0.1 mg, Catalog No 21233338" is 1.