Human BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein ( KCTD10) Protein (E coli), 500 ug

Human BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein ( KCTD10) Protein (E coli), 500 ug

$499.00
21233335
In stock
Our quantity discounts:
Quantity 10+ 100+
Price $50.00 $40.00

Minimum quantity for "Human BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein ( KCTD10) Protein (E coli), 500 ug" is 1.

hKCTD10 Product Information

Synonym

BTB/POZ domain-containing protein KCTD10; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3; potassium channel tetramerization domain-containing protein 10; potassium channel tetramerisation domain containing 10

Summary

The protein is reported to bind proliferating cell nuclear antigen (PCNA)[1], and may be involved in DNA synthesis and cell proliferation, function as a tumor suppressor[2]. Several protein-coding and non-protein coding transcript variants have been found in human genome.

Protein Construction

Full length of human hKCTD 10 cDNA was cloned into AprexBio expression vector.

Source

Homo sapiens

Expression Host

 E coli BL21

Protein Sequence

MGSEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVL
TDSEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQQNKDTYEPF
CKVPVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVI
GDEICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGG
AAGRSHHLDEDEERERIERVRRIHIKRPDDRAHLHQLE DDDDKGGGGSGGGGSGGGSHHHHHH

hKCTD10 Protein QC Testing

Purity

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant hKCTD10

Stability

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass

38.2 kDa

Formulation

In sterile PBS, pH 7.4, with 0.02% sodium azide

Protein Storage

Storage:

Store it under sterile conditions at -70oC It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

C0220114
$99.00

AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU

In stock

Minimum quantity for "AmeriDx® bovine Enterokinase (bEK) Protein, 100 IU" is 1.


21233339
$435.00

AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal Q93-E396 , from 0.1 mg, Catalog No 21233339

In stock

Minimum quantity for "AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal Q93-E396 , from 0.1 mg, Catalog No 21233339" is 1.


21233338
$435.00

AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal S2-D338 , from 0.1 mg, Catalog No 21233338

In stock

Minimum quantity for "AmeriDx® Neurofilament Light Polypeptide Protein (NF-L) N terminal S2-D338 , from 0.1 mg, Catalog No 21233338" is 1.


21233337
$435.00

AmeriDx® Neurofilament Light Polypeptide Protein (NF-L), 0.1 mg

In stock

Minimum quantity for "AmeriDx® Neurofilament Light Polypeptide Protein (NF-L), from 0.1 mg, Catalog No 21233337" is 1.


21231221M
$250.00

Growth Differentiation Factor 11, also known as: BMP11; BMP-11. This protein is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in mice and Xenopus suggest that this protein is involved in mesodermal formation and neurogenesis during embryonic development.

In stock

Minimum quantity for "Growth Differentiation Factor 11 (GDF11), 10 ug" is 1.