hKCTD10 Product Information
Synonym | BTB/POZ domain-containing protein KCTD10; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3; potassium channel tetramerization domain-containing protein 10; potassium channel tetramerisation domain containing 10 |
Summary | The protein is reported to bind proliferating cell nuclear antigen (PCNA)[1], and may be involved in DNA synthesis and cell proliferation, function as a tumor suppressor[2]. Several protein-coding and non-protein coding transcript variants have been found in human genome. |
Protein Construction | Full length of human hKCTD 10 cDNA was cloned into AprexBio expression vector. |
Source | Homo sapiens |
Expression Host | E coli BL21 |
Protein Sequence | MGSEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTLTKQDTMLKAMFSGRMEVL TDSEGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGLVEECQAALQQNKDTYEPF CKVPVITSSKEEQKLIATSNKPAVKLLYNRSNNKYSYTSNSDDNMLKNIELFDKLSLRFNGRVLFIKDVI GDEICCWSFYGQGRKIAEVCCTSIVYATEKKQTKVEFPEARIYEETLNILLYEAQDGRGPDNALLEATGG AAGRSHHLDEDEERERIERVRRIHIKRPDDRAHLHQLE DDDDKGGGGSGGGGSGGGSHHHHHH |
hKCTD10 Protein QC Testing
Purity | > 95 % as determined by SDS-PAGE | SDS-PAGE:
|
Stability | Samples are stable for up to twelve months from date of receipt at -70oC | |
Molecular Mass | 38.2 kDa | |
Formulation | In sterile PBS, pH 7.4, with 0.02% sodium azide |
Protein Storage
Storage: | Store it under sterile conditions at -70oC It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution: | A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information. |