Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Recombinant Human sterol O-acyltransferase 1 (SOAT1) protein, 0.5 mg

Images
 
Product Details
Summary
$299.00
21231272
In stock
+
Our quantity discounts:
Quantity 2+ 5+
Price $250.00 $220.00

Minimum quantity for "Recombinant Human sterol O-acyltransferase 1 (SOAT1) protein, 0.5 mg" is 1.

Note
 

Recombinant Human sterol O-acyltransferase 1 (SOAT1) protein,  0.5 mg

Product Description
 

Recombinant human Sterol O-acyltransferase 1 (SOAT1) Protein, (Cat# 21231272) 

Hepatitis B virus (HBV)-related hepatocellular carcinoma (HCC) remains a major public health problem and its pathogenesis remains unresolved. A recent proteomics study discovered a lipid enzyme Sterol O-acyltransferase (SOAT1) involvement in the progression of HCC. We aimed to explore the association between SOAT1 genetic variation and HCC.

Product Information

Synonym :

sterol O-acyltransferase 1 (SOAT1, ACACT, ACAT, ACAT-1, ACAT1, SOAT, STAT)

Protein Construction:

Recombinant protein with his tag at C terminal

Source:

Homo sapiens

Expression Host:

E coli.

Sequence:

MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVG SHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRT IYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGY SKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLN SAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFR NIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIV NDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVFHHHHHHHH

NGAL QC Testing Results

Purity:

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant Human SOAT1 

Stability:

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass:

~65 kDa in SDS-PAGE under reducing conditions

Formulation:

In 1x PBS with 10% Glycerol


Protein Storage

Storage:

Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

Product Documents

COA is available upon request.

Free Sample is available upon request.



Product PDFs
 
Related Products
 

$300.00
In stock




$210.00
In stock








$110.00
In stock












$80.00 $69.00
In stock








$299.00
In stock

$299.00
In stock

$299.00
In stock

$299.00
In stock

$299.00
In stock


$299.00
In stock