Recombinant Human sterol O-acyltransferase 1 (SOAT1) protein, 0.5 mg
Images
Product Details
Note
Recombinant Human sterol O-acyltransferase 1 (SOAT1) protein, 0.5 mg
Please sign in so that we can notify you about a reply
Product Description
Recombinant human Sterol O-acyltransferase 1 (SOAT1) Protein, (Cat# 21231272)
Hepatitis B virus (HBV)-related hepatocellular carcinoma (HCC) remains a major public health problem and its pathogenesis remains unresolved. A recent proteomics study discovered a lipid enzyme Sterol O-acyltransferase (SOAT1) involvement in the progression of HCC. We aimed to explore the association between SOAT1 genetic variation and HCC.
Product Information
Synonym : | sterol O-acyltransferase 1 (SOAT1, ACACT, ACAT, ACAT-1, ACAT1, SOAT, STAT) |
Protein Construction: | Recombinant protein with his tag at C terminal |
Source: | Homo sapiens |
Expression Host: | E coli. |
Sequence: | MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVG SHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRT IYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGY SKSSHPLIRSLFHGFLFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLN SAKEKSSTVPIPTVNQYLYFLFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFR NIKQEPFSARVLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIV NDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVRPRSWTCRYVFHHHHHHHH |
NGAL QC Testing Results
Purity: | > 95 % as determined by SDS-PAGE | SDS-PAGE: Recombinant Human SOAT1 |
Stability: | Samples are stable for up to twelve months from date of receipt at -70oC | |
Molecular Mass: | ~65 kDa in SDS-PAGE under reducing conditions | |
Formulation: | In 1x PBS with 10% Glycerol |
Protein Storage
Storage: | Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution: | A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information. |
Product Documents
COA is available upon request.
Free Sample is available upon request.