GIF Antigen (Cat# 21231272), 1 mg / 10 mg
Gastric Intrinsic Factor (GIF) encodes a glycoprotein required for adequate absorption of vitamin B12 in the terminal ileum. Vitamin B12(cobalamin) is a water-soluble vitamin and is essential for the growth and development of all mammals, including humans. GIF promoter Vitamin B12 entry through endocytosis.
GIF Protein Product Information
Synonym : | Intrinsic Factor (IF), GIF, Cobalamin/Vitamin B-12 binding transport Protein |
Protein Construction: | Recombinant protein with his tag at C terminal |
Source: | Homo sapiens |
Expression Host: | E coli. |
Sequence: | MSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSD NNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEA TLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIK DNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYL DVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVL EEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITAN FTQYGSGHHHHHHHH |
NGAL QC Testing Results
Purity: | > 95 % as determined by SDS-PAGE | SDS-PAGE:
Recombinant Human GIF Antigen |
Stability: | Samples are stable for up to twelve months from date of receipt at -70oC | |
Molecular Mass: | 45 kDa in SDS-PAGE under reducing conditions | |
Formulation: | In 1x PBS with 10% Glycerol |
Protein Storage
Storage: | Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution: | A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information. |
Product Documents
COA is available upon request.
Free Sample is available upon request.
Key Reference
1.Chery et al 2013. Gastric intrinsic factor deficiency with combine dGIF herterozygous mutation and FUT2 secretor variant. Biochimie 95: 995-1001.
2.Tang et al 1992. The Instrinsic Factor (IF)-Cobalamin receptor Binding Site is Located in the Amnino-terminal Portion of IF. Journal of Biological Chemistry 267: 22982-22986.