Recombinant Chikungunya virus RNA Dependent RNA Polymerase (RdRp, Cat# 21231285)
Chikungunya virus (CHIKV) is a alphavirus having about 30 members. It is originated in Africa, carried by mosquito, and enters human via mosquito bite. Common symptoms for this virial infectious are chikungunya fever, joint pain/swelling, headache, muscle pain, skin rash.
Several methods can be used for Chikungunya Virus diagnosis, including enzyme-linked immunosorbent assays (ELISA) and molecular identification (RT-PCR). ELISA may confirm the presence of IgM and IgG anti-chikungunya antibodies after virus infection. IgG could be detected as early as a couple of days, and last for more than 3 months, IgM antibody appears in about 3-5 weeks, persists for about 2 months. Samples collected during the first week after the onset of symptoms should be tested by both serological and virological methods (RT-PCR).
Protein Product Information
| Synonym : | n/a | |
| GeneBank Acc#: | QBC65300.1/1841A-2454K | |
Protein Construction: | Recombinant Chikungunya RdRp with his tag at C terminal | |
Source: | Chikungunya virus | |
| Expression Host: | Insect cells sf9 | |
| Sequence: | MAGGYIFSSDTGPGHLQQKSVRQSVLPVNTLEEVHEEKCYPPKLDELKEQ LLLKKLQESASTANRSRYQSRKVENMKATIIQRLKRGCKLYLMAETPKVP TYRTVYPAPVYSPPINVRLSNPESAVAACNEFLARNYPTVSSYQITDEYD AYLDMVDGSESCLDRATFNPSKLRSYPKQHAYHAPSIRSAVPSPFQNTLQ NVLAAATKRNCNVTQMRELPTLDSAVFNVECFKKFACNREYWEEFAASPI RITTENLTTYVTKLKGPKAAALLARTHNLLPLQDVPMDRFTVDMKRDVKV TPGTKHTEERPKVQVIQAAEPLATAYLCGIHRELVRRLNAVLLPNVHTLF DMSAEDFDAIIAAHFKPGDAVLETDIASFDKSQDDSLALTALMLLEDLGV DHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITI ASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDA VVSQKAPYFCGGFILHDTVTGTACRVADPLKRLFKLGKPLAAGDEQDEDR RRALADEVIRWQRTGLIDELEKAVYSRYEVQGISVAVMSMATFASSRSNF EKLRGPVITLYGGPK | |
Purity: | > 95 % as determined by SDS-PAGE | SDS-PAGE: Recombinant CHHIK Virus Antigen RdRp |
Stability: | Samples are stable for up to twelve months from date of receipt at -70oC | |
| Molecular Mass: | 69 kDa in SDS-PAGE under reducing conditions | |
Formulation: | In 1x PBS with 10% Glycerol | |
Storage: | Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. | |
Reconstitution: | A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information. | |
Product Documents
COA is available upon request.
Free Sample is available upon request.
Key Reference
1. Theres George, A., et al. (2019). "Label-Free Detection of Chikungunya Non-Structural Protein 3 Using Electrochemical Impedance Spectroscopy." Journal of The Electrochemical Society 166: B1356-B1363.
2. Jain, J., et al. (2018). "Evaluation of an immunochromatography rapid diagnosis kit for detection of chikungunya virus antigen in India, a dengue-endemic country." Virology Journal 15.