Recombinant Human pyridoxal kinase (PDXK, Cat# 21231279), 1 mg / 10 mg
The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
PDXK Protein Product Information
Synonym : | PKH; PNK; PRED79 |
GeneBank Acc# : | AAH21550.1 |
Protein Construction: | Recombinant protein with his tag at C terminal |
Source: | Homo sapiens |
Expression Host: | E coli. |
Sequence: | MGHKARLPAGTRVFHTSCVVGSLTPFRLGGGKADPPSACRAHLAQASPP RGCCSHFCPFPRPGPRSLRPY HKVRSFFHTVSWAWQSLHLVASIPSGP FERISWSSLSELPGLRALGRSLRSWRSAGGRVALSWLSECRARGDGTGA LLLGLVVPAAGKGQL |
NGAL QC Testing Results
Purity: | > 95 % as determined by SDS-PAGE | SDS-PAGE: Recombinant Human GIF Antigen |
Stability: | Samples are stable for up to twelve months from date of receipt at -70oC | |
Molecular Mass: | 18 kDa in SDS-PAGE under reducing conditions | |
Formulation: | In 1x PBS with 10% Glycerol |
Protein Storage
Storage: | Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution: | A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information. |
Product Documents
COA is available upon request.
Free Sample is available upon request.
Key Reference
1.Chery et al 2013. Gastric intrinsic factor deficiency with combine dGIF herterozygous mutation and FUT2 secretor variant. Biochimie 95: 995-1001.
2.Tang et al 1992. The Instrinsic Factor (IF)-Cobalamin receptor Binding Site is Located in the Amnino-terminal Portion of IF. Journal of Biological Chemistry 267: 22982-22986.