Catalog Number: 21231247
Size: 100 ug
Source: E. coli derived H. pylori Urease subunit A (UreA) protein
NCBI ID: AAK69738
Sequences:
MKLTPKELDKLMLHYAGELARKRKEKGIKLNYVEAVALISAHIMEEARAGKKSAAELMQEGRSLLKPDDV MDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQ IGSHFHFFEVNRYLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNES KKIALHRAKERGFHGAKSDDNYVKTIKE
Host: E. coli
Format: Dry Powder
Reactivity: Immune assay with AmeriDx® H. pylori UreA antibodies.
QC Testing: Concentration Measurement, SDS-PAGE Analysis.
Formulation and Purity
Recombinant protein accession no AAK69738, over-expressed in E coli strain BL21, and affinity purification from cell pellet by Ni-NTA resin, and dialysis against 1x PBS. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured by Nanodrop.
Storage Buffer: In PBS before lyophilized
Preparation and Storage
Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.
Description
This enzyme may allow it to remain active at the cell surface at acidic gastric pH. Within this dodecameric structure the 12 active sites are clustered within the interior of the proteinaceous shell. This may allow a high local concentration of ammonia within the enzyme which may protect the nickel-chelating groups from protonation (https://www.uniprot.org/uniprot/P14916).
Product Notices
- Since applications vary, each investigator should titrate the reagent to obtain optimal results.
- Please refer to www.ameridx.com/ for technical protocols.
References
1. Olivera-Severo, D., et al. (2017). "A New Role for Helicobacter pylori Urease: Contributions to Angiogenesis." Front Microbiol 8(1883).
Product Insert can be after login.