Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

AmeriDx® Recombinant Poliovirus RdRp Protein (21231287), 1 mg

Recombinant Poliovirus RdRp Protein

$299.00
21231287
In stock

Minimum quantity for "AmeriDx® Recombinant Poliovirus RdRp Protein (21231287), 1 mg" is 1.

Catalog Number: 21231287

Size: 1 mg

Source: RdRp (3Dpol) protein from insect sf9 cells.

             NCBI ID: AIS73056/1762E-2188F

Sequences:

GSEGSKEPAVLNPKDPRLKTDFEEAIFSKYTGNKIMLMDEYMEEAVDHYVGCLEPLDISVDPIPLESAMYGMDGLEALDL
TTSAGFPYLLQGKKKRDIFNRHTRDTTEMTKMLEKYGVDLPFVTFVKDELRSREKVEKGKSRLIEASSLNDSVAMRVAFG
NLYATFHSNPGTATGSAVGCDPDIFWSKIPILLDGEIFAFDYTGYDASLSPVWFACLKKVLIKLGYTHQTSFIDYLCHSV
HLYKDRKYIVNGGMPSGSSGTSIFNTMINNIIIRTLLIRVYKGIDLDQFKMIAYGDDVIASYPHKIDPGLLAEAGKHYGL
VMTPADKGTSFVDTNWENVTFLKRYFRADDQYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCYLAWHNGEEAYDEF
CRKIRSVPVGRALTLPAYSSLRRKWLDSFLER

Host: sf9 cells

Format: Dry Powder

Reactivity: Immune assay with RdRp monoclonal antibody.

QC Testing: Concentration Measurement, SDS-PAGE Analysis.

Formulation and Purity

Recombinant protein AIS73056 region 1762E-2188F with 6-Histine tag at C-terminal from insect cells sf9 in 1 x PBS. The protein is > 97% pure, as determined by SDS-PAGE. The concentration is measured by Nanodrop.

Storage Buffer: In PBS before lyophilized

Preparation and Storage

Upon received, save at freezer immediately if not used. After initial reconstitution with DI water (50-100uL), aliquot if necessary, and save the product at -80°C for future use.

Description

Polio virus RdRp protein is key player in virus invading into human cells, and virus RNA replication inside human cells[1,2,3]. the protein has a right hand palm structure, similar to covid-19 RdRp, zika virus RdRp and dengue virus RdRp proteins[4,5]

                  

The purified protein is part of full length RdRp protein with a c-terminal his tag.

Product Notices

  • Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  • Please refer to www.ameridx.com/ for technical protocols.

References

1.   Comunale, B. A., et al. (2021). "Poliovirus Vaccination Induces a Humoral Immune Response That Cross Reacts With SARS-CoV-2." Frontiers in Medicine 8(1285).

2. Wolf YI, Kazlauskas D, Iranzo J, Lucía-Sanz A, Kuhn JH, Krupovic M, et al. Origins and evolution of the global RNA virome. MBio. (2018) 9:e02329–18. doi: 10.1128/mBio.02329-18.

3. Arya R, Kumari S, Pandey B, Mistry H, Bihani SC, Das A, Prashar V, Gupta GD, Panicker L, Kumar M. Structural insights into SARS-CoV-2 proteins. J Mol Biol. 2021 Jan 22;433(2):166725. doi: 10.1016/j.jmb.2020.11.024. Epub 2020 Nov 24. PMID: 33245961; PMCID: PMC7685130.

4. Venkataraman S, Prasad BVLS, Selvarajan R. RNA Dependent RNA Polymerases: Insights from Structure, Function and Evolution. Viruses. 2018 Feb 10;10(2):76. doi: 10.3390/v10020076. PMID: 29439438; PMCID: PMC5850383.

5. Lu G, Gong P. A structural view of the RNA-dependent RNA polymerases from the Flavivirus genus. Virus Res. 2017 Apr 15;234:34-43. doi: 10.1016/j.virusres.2017.01.020. Epub 2017 Jan 25. PMID: 28131854.

Product Insert can be after login.

R30142004
$450.00

AmeriDx® Fecal H. pylori Ag Rapid Test Kit is an in vitro qualitative immunochromatographic assay for the rapid detection of Helicobacter pylori (H. pylori) antigens in human stool specimen. The test results are intended to aid in the diagnosis of H. pylori infection, to monitor the effectiveness of therapeutic treatment, and to confirm the eradication of H. pylori in patients with peptic ulcer.

In stock

B21231168
$230.00 $190.00


Mouse monoclonal Anti-Helicobacter pylori (H. Pylori) antibody, DEAE chromatography purified.

In stock

Minimum quantity for "Anti-Helicobacter pylori (H. Pylori) Mouse Monoclonal Antibody, 1 mg (Cat# B21231168)" is 1.


B21231169
$230.00 $190.00

Mouse monoclonal Anti-Helicobacter pylori (H. Pylori) antibody, DEAE chromatography purified.

In stock

Minimum quantity for "Anti-Helicobacter pylori (H. Pylori) Mouse Monoclonal Antibody, 1 mg (Cat# B21231169)" is 1.