Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Recombinant Human Gastric Intrisic factor (GIF), 1 mg

299
21231272
In stock
+
Our quantity discounts:
Quantity 2+ 5+
Price 250 220

Minimum quantity for "Recombinant Human Gastric Intrisic factor (GIF), 1 mg" is 1.

GIF Antigen (Cat# 21231272)

Gastric Intrinsic Factor (GIF) encodes a glycoprotein required for adequate absorption of vitamin B12 in the terminal ileum. Vitamin B12(cobalamin) is a water-soluble vitamin and  is essential for the growth and development of all mammals, including humans. GIF  promoter Vitamin B12 entry through endocytosis. 


GIF Protein Product Information

Synonym :

Intrinsic Factor(IF), GIF, Cobalamin/Vitamin B-12 binding transport Protein

Protein Construction:

Recombinant protein with his tag at C terminal

Source:

Homo sapiens

Expression Host:

E coli.

Sequence:

MSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSD NNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEA TLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIK DNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYL DVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVL EEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITAN FTQYGSGHHHHHHHH

NGAL QC Testing Results

Purity:

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant Human GIF Antigen

Stability:

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass:

45 kDa in SDS-PAGE under reducing conditions

Formulation:

In 1x PBS with 10% Glycerol


Protein Storage

Storage:

Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

Product Documents

COA is available upon request.

Free Sample is available upon request.

Key Reference

1.Chery et al 2013. Gastric intrinsic factor deficiency with combine dGIF herterozygous mutation and FUT2 secretor variant. Biochimie 95: 995-1001.
2.Tang et al 1992.  The Instrinsic Factor (IF)-Cobalamin receptor Binding Site is Located in the Amnino-terminal Portion of IF. Journal of Biological Chemistry 267: 22982-22986.


E20142015
750

Human GIF ELISA for serum, plasma and cell culture supernatants

In stock