Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Recombinant Dengue virus RdRp protein, 1 mg

Recombinant Dengue virus RdRp Protein

$299.00
21231282
In stock
+
Our quantity discounts:
Quantity 2+ 5+
Price $250.00 $220.00

Minimum quantity for "Recombinant Dengue virus RdRp protein, 1 mg" is 1.

Recombinant Dengue virus RNA Dependent RNA Polymerase (RdRp, Cat# 21231282) 

T


Protein Product Information

Synonym :n/a
GeneBank Acc#:4C11_A

Protein Construction:

Recombinant Dengue virus RdRp with his tag at C terminal

Source:

Dengue virus
Expression Host:

Insect cells sf9

Sequence:
HVNAEPETPNMDVIGERIKRIKEEHNSTWHYDDENPYKTWAYHGSYEVKATGSASSMINGVVKLLTKPWD
VVPMVTQMAMTDTTPFGQQRVFKEKVDTRTPRPLPGTRKVMEITAEWLWRTLGRNKRPRLCTREEFTKKV
RTNAAMGAVFTEENQWDSAKAAVEDEEFWKLVDRERELHKLGKCGSCVYNMKGKREKKLGEFGKAKGSRA
IWYMWLGVRYLEFEALGFLNEDHWFSRENSYSGVEGEGLHKLGYILRDISKIPGGAMYADDTAGWDTRIT
EDDLHNEEKIIQQMDPEHRQLANAIFKLTYQNKVVKVQRPTPTGTVMDIISRKDQRGSGQVGTYGLNTFT
NMEAQLVRQMEGEGVLTKADLENPHLLEKKITQWLETKGVERLKRMAISGDDCVVKPIDDRFANALLALN
DMGKVRKDIPQWQPSKGWHDWQQVPFCSHHFHELIMKDGRKLVVPCRPQDELIGRARISQGAGWSLRETA
CLGKAYAQMWSLMYFHRRDLRLASNAICSAVPVHWVPTSRTTWSIHAHHQWMTTEDMLTVWNRVWIEENP
WMEDKTPVTTWENVPYLGKREDQWCGSLIGLTSRATWAQNIPTAIQQVRSLIGNEEFLDYMPSMKRFRKE
EESEGAIW

Purity:

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant Dengue Virus Antigen

Stability:

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass:  74  kDa in SDS-PAGE under reducing conditions

Formulation:

In 1x PBS with 10% Glycerol

Storage:

Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

Product Documents

COA is available upon request.

Free Sample is available upon request.

Key Reference

1. Theres George, A., et al. (2019). "Label-Free Detection of Chikungunya Non-Structural Protein 3 Using Electrochemical Impedance Spectroscopy." Journal of The Electrochemical Society 166: B1356-B1363.

2. Jain, J., et al. (2018). "Evaluation of an immunochromatography rapid diagnosis kit for detection of chikungunya virus antigen in India, a dengue-endemic country." Virology Journal 15.

21231285
$299.00

Recombinant Chikungunya virus RdRp

In stock

Minimum quantity for "Recombinant Chikungunya virus RdRp (Cat# 21231285), 1 mg" is 1.