Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Recombinant Chikungunya virus RdRp (Cat# 21231285), 1 mg

Recombinant Chikungunya virus RdRp

$299.00
21231285
In stock
+
Our quantity discounts:
Quantity 2+ 5+
Price $250.00 $220.00

Minimum quantity for "Recombinant Chikungunya virus RdRp (Cat# 21231285), 1 mg" is 1.

Recombinant Chikungunya virus RNA Dependent RNA Polymerase (RdRp, Cat# 21231285) 

Chikungunya virus (CHIKV) is a alphavirus having about 30 members. It is originated in Africa, carried by mosquito, and enters human via mosquito bite. Common symptoms for this virial infectious are chikungunya fever, joint pain/swelling, headache, muscle pain, skin rash.
Several methods can be used for Chikungunya Virus diagnosis, including enzyme-linked immunosorbent assays (ELISA) and molecular identification (RT-PCR). ELISA may confirm the presence of IgM and IgG anti-chikungunya antibodies after virus infection. IgG could be detected as early as a couple of days, and last for more than 3 months, IgM antibody appears in about 3-5 weeks, persists for about 2 months. Samples collected during the first week after the onset of symptoms should be tested by both serological and virological methods (RT-PCR).


Protein Product Information

Synonym :n/a
GeneBank Acc#:QBC65300.1/1841A-2454K

Protein Construction:

Recombinant Chikungunya RdRp with his tag at C terminal

Source:

Chikungunya virus
Expression Host:

Insect cells sf9

Sequence:
MAGGYIFSSDTGPGHLQQKSVRQSVLPVNTLEEVHEEKCYPPKLDELKEQ
LLLKKLQESASTANRSRYQSRKVENMKATIIQRLKRGCKLYLMAETPKVP
TYRTVYPAPVYSPPINVRLSNPESAVAACNEFLARNYPTVSSYQITDEYD
AYLDMVDGSESCLDRATFNPSKLRSYPKQHAYHAPSIRSAVPSPFQNTLQ
NVLAAATKRNCNVTQMRELPTLDSAVFNVECFKKFACNREYWEEFAASPI
RITTENLTTYVTKLKGPKAAALLARTHNLLPLQDVPMDRFTVDMKRDVKV
TPGTKHTEERPKVQVIQAAEPLATAYLCGIHRELVRRLNAVLLPNVHTLF
DMSAEDFDAIIAAHFKPGDAVLETDIASFDKSQDDSLALTALMLLEDLGV
DHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITI
ASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDA
VVSQKAPYFCGGFILHDTVTGTACRVADPLKRLFKLGKPLAAGDEQDEDR
RRALADEVIRWQRTGLIDELEKAVYSRYEVQGISVAVMSMATFASSRSNF
EKLRGPVITLYGGPK

Purity:

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant CHHIK Virus Antigen RdRp

Stability:

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass:69 kDa in SDS-PAGE under reducing conditions

Formulation:

In 1x PBS with 10% Glycerol

Storage:

Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

Product Documents

COA is available upon request.

Free Sample is available upon request.

Key Reference

1. Theres George, A., et al. (2019). "Label-Free Detection of Chikungunya Non-Structural Protein 3 Using Electrochemical Impedance Spectroscopy." Journal of The Electrochemical Society 166: B1356-B1363.

2. Jain, J., et al. (2018). "Evaluation of an immunochromatography rapid diagnosis kit for detection of chikungunya virus antigen in India, a dengue-endemic country." Virology Journal 15.

21231334
$299.00

Recombinant Chikungunya virus E proteins and S3 protein

In stock

Minimum quantity for "Recombinant Chikungunya virus E protein, 1 mg" is 1.


21231282
$299.00

Recombinant Dengue virus RdRp Protein

In stock

Minimum quantity for "Recombinant Dengue virus RdRp protein, 1 mg" is 1.


21231288
$290.00

Recombinant Zika Virus RdRp Protein


In stock

Minimum quantity for "Recombinant Zika Virus RdRp Protein (Cat# 21231288), 1 mg" is 1.