Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Recombinant SARS CoV-2 virus RdRp (Cat# 21231294), 1 mg

Recombinant SARS CoV-2 virus RdRp

$299.00
21231294
In stock
+
Our quantity discounts:
Quantity 2+ 5+
Price $250.00 $220.00

Minimum quantity for "Recombinant SARS CoV-2 virus RdRp (Cat# 21231294), 1 mg" is 1.

Recombinant SARS CoV-2 virus RNA Dependent RNA Polymerase (RdRp, Cat# 21231294) 

SARS CoV-2 virus (Covid-2) is a virus cause 2019 pandemic, and last for several years, it killed millions of people from December 2019 to October 2021, caused million of billions of dollar lost in global economy. SARS-CoV-2 and the poliovirus are positive ssRNA viruses, whose genomic RNA can be directly used as a protein translation template, as well as for genomic replication driven by an RNA-dependent -RNA -polymerase (RdRp) protein that is translated from the viral template[1].  

Protein Product Information

Synonym :n/a
GeneBank Acc#:MN908947

Protein Construction:

Recombinant Covid-2 RdRp with his tag at C terminal

Source:

SARS CoV-2 virus
Expression Host:

Insect cells sf9

Sequence:
MSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEK
DEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRL
TKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLG
ERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYS
LLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCV
NCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDV
NLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDF
YDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKY
FDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTI
TQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWH
NMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANEC
AQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKY
VRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASI
KNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILG
AGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHM
LDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQS

Purity:

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant Covid-2 Virus Antigen RdRp

Stability:

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass:107 kDa in SDS-PAGE under reducing conditions

Formulation:

In 1x PBS with 10% Glycerol

Storage:

Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

Product Documents

COA is available upon request.

Free Sample is available upon request.

Key Reference

1. Comunale, B. A., et al. (2021). "Poliovirus Vaccination Induces a Humoral Immune Response That Cross Reacts With SARS-CoV-2." Frontiers in Medicine 8(1285).


21231334
$299.00

Recombinant Chikungunya virus E proteins and S3 protein

In stock

Minimum quantity for "Recombinant Chikungunya virus E protein, 1 mg" is 1.


21231282
$299.00

Recombinant Dengue virus RdRp Protein

In stock

Minimum quantity for "Recombinant Dengue virus RdRp protein, 1 mg" is 1.


21231288
$290.00

Recombinant Zika Virus RdRp Protein


In stock

Minimum quantity for "Recombinant Zika Virus RdRp Protein (Cat# 21231288), 1 mg" is 1.


21231287
$299.00

Recombinant Poliovirus RdRp Protein

In stock

Minimum quantity for "AmeriDx® Recombinant Poliovirus RdRp Protein (21231287), 1 mg" is 1.