Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Recombinant Human PUF60 Protein, 1 mg

Recombinant Human Pyridoxal phosphatase PUF60

$299.00
21231279
In stock
+
Our quantity discounts:
Quantity 2+ 5+
Price $250.00 $220.00

Minimum quantity for "Recombinant Human PUF60 Protein, 1 mg" is 1.

Recombinant Human Pyridoxal phosphatase (PUF60, Cat# 21231276) 

Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM, Mar 2008]


PUF60 Protein Product Information

Synonym :

PDXP; CIN; dJ37E16.5; FLJ32703; PLP

GeneBank Acc# :

AAH00320.1

Protein Construction:

Recombinant protein with his tag at C terminal

Source:

Homo sapiens

Expression Host:

E coli.  

Sequence:

MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELAL
RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAA 
PRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVATDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALV 
VGKPSPYMFECITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP 
HYYVESIADLTEGLED

Purity:

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant Human GIF Antigen

Stability:

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass:

32 kDa in SDS-PAGE under reducing conditions

Formulation:

In 1x PBS with 10% Glycerol


Protein Storage

Storage:

Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

Product Documents

COA is available upon request.

Free Sample is available upon request.

Key Reference

1.Chery et al 2013. Gastric intrinsic factor deficiency with combine dGIF herterozygous mutation and FUT2 secretor variant. Biochimie 95: 995-1001.
2.Tang et al 1992.  The Instrinsic Factor (IF)-Cobalamin receptor Binding Site is Located in the Amnino-terminal Portion of IF. Journal of Biological Chemistry 267: 22982-22986.


E20142015
$750.00

Human GIF ELISA for serum, plasma and cell culture supernatants

In stock

21231272
$299.00

Neutrophil gelatinase-associated lipocalin. Also known as: 24p3, MSFI, LCN2. Human NGAL is encoded by the LCN2 gene. NGAL is involved in innate immunity by sequestrating iron that in turn limits bacterial growth. It is expressed in neutrophils and in low levels in the kidney, prostate, and epithelia of the respiratory and alimentary tracts. NGAL is used as a biomarker of kidney injury.

In stock

Minimum quantity for "Recombinant Human Gastric Intrisic factor (GIF), 1 mg" is 1.


21231278
$299.00

human recombinant FUT2, B12QTL1; SE; Se2; SEC2; sej

In stock

Minimum quantity for "Recombinant Human FUT2 Protein, 1 mg" is 1.


21231279
$299.00

Recombinant Human pyridoxal kinase (PDXK, Cat# 21231279) 

In stock

Minimum quantity for "Recombinant Human PDXK Protein, 1 mg" is 1.