Warning Cookies are used on this site to provide the best user experience. If you continue, we assume that you agree to receive cookies from this site. OK

Recombinant Human Coronavirus NL63 RdRp (Cat# 21231291), 1 mg

Recombinant Human Coronavirus NL63 RdRp

$299.00
21231294
In stock
+
Our quantity discounts:
Quantity 2+ 5+
Price $250.00 $220.00

Minimum quantity for "Recombinant Human Coronavirus NL63 RdRp (Cat# 21231291), 1 mg" is 1.

Recombinant Human Coronavirus RNA Dependent RNA Polymerase (RdRp, Cat# 21231291) 

SARS CoV virus is a virus cause 2003 pandemic in east Aian, caused million of billions of dollar lost in global economy. SARS-CoV, SARS CoV-2 and the poliovirus are positive ssRNA viruses, whose genomic RNA can be directly used as a protein translation template, as well as for genomic replication driven by an RNA-dependent -RNA -polymerase (RdRp) protein that is translated from the viral template[1].  

Protein Product Information

Synonym :n/a
GeneBank Acc#:QDH43737.1/4043S-4965Q

Protein Construction:

Recombinant human coronavirus RdRp with his tag at C terminal

Source:

Human coronavirus
Expression Host:

Insect cells sf9

Sequence:
LGKCLKMNCVRFKNADLKDGYFVIKRCTKSVMEHEQSMYNLLNFSGALAEHDFFTWKDGRVIYGNVSRHN
LTKYTMMDLVYAMRNFDEQNCDVLKEVLVLTGCCDNSYFDSKGWYDPVENEDIHRVYASLGKIVARAMLK
CVALCDAMVAKGVVGVLTLDNQDLNGNFYDFGDFVVSLPNMGVPCCTSYYSYMMPIMGLTNCLASECFVK
SDIFGSDFKTFDLLKYDFTEHKENLFNKYFKHWSFDYHPNCSDCYDDMCVIHCANFNTLFATTIPGTAFG
PLCRKVFIDGVPLVTTAGYHFKQLGLVWNKDVNTHSVRLTITELLQFVTDPSLIIASSPALVDQRTICFS
VAALSTGLTNQVVKPGHFNEEFYNFLRLRGFFDEGSELTLKHFFFAQNGDAAVKDFDFYRYNKPTILDIC
QARVTYKIVSRYFDIYEGGCIKACEVVVTNLNKSAGWPLNKFGKASLYYESISYEEQDALFALTKRNVLP
TMTQLNLKYAISGKERARTVGGVSLLSTMTTRQYHQKHLKSIVNTRNATVVIGTTKFYGGWNNMLRTLID
GVENPMLMGWDYPKCDRALPNMIRMISAMVLGSKHVNCCTATDRFYRLGNELAQVLTEVVYSNGGFYFKP
GGTTSGDASTAYANSIFNIFQAVSSNINRLLSVPSDSCNNVNVRDLQRRLYDNCYRLTSVEESFIDDYYG
YLRKHFSMMILSDDGVVCYNKDYAELGYIADISAFKATLYYQNNVFMSTSKCWVEEDLTKGPHEFCSQHT
MQIVDKDGTYYLPYPDPSRILSAGVFVDDVVKTDAVVLLERYVSLAIDAYPLSKHPNSEYRKVFYVLLDW
VKHLNKNLNEGVLESFSVTLLDNQEDKFWCEDFYASMYENSTILQAAGLC

Purity:

> 95 % as determined by SDS-PAGE

SDS-PAGE:


Recombinant Human coronavirus NL632  Antigen RdRp

Stability:

Samples are stable for up to twelve months from date of receipt at -70oC

Molecular Mass:101 kDa in SDS-PAGE under reducing conditions

Formulation:

In 1x PBS with 10% Glycerol

Storage:

Store it under sterile conditions at -70oC once it is received. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Reconstitution:

A hard copy of COA with reconstitution instructions is sent along with the products. Please refer to it for more detailed information.

Product Documents

COA is available upon request.

Free Sample is available upon request.

Key Reference

1. Comunale, B. A., et al. (2021). "Poliovirus Vaccination Induces a Humoral Immune Response That Cross Reacts With SARS-CoV-2." Frontiers in Medicine 8(1285).


21231334
$299.00

Recombinant Chikungunya virus E proteins and S3 protein

In stock

Minimum quantity for "Recombinant Chikungunya virus E protein, 1 mg" is 1.


21231282
$299.00

Recombinant Dengue virus RdRp Protein

In stock

Minimum quantity for "Recombinant Dengue virus RdRp protein, 1 mg" is 1.


21231288
$290.00

Recombinant Zika Virus RdRp Protein


In stock

Minimum quantity for "Recombinant Zika Virus RdRp Protein (Cat# 21231288), 1 mg" is 1.


21231287
$299.00

Recombinant Poliovirus RdRp Protein

In stock

Minimum quantity for "AmeriDx® Recombinant Poliovirus RdRp Protein (21231287), 1 mg" is 1.


21231294
$299.00

Recombinant SARS CoV-2 virus RdRp

In stock

Minimum quantity for "Recombinant SARS CoV-2 virus RdRp (Cat# 21231294), 1 mg" is 1.